DPCstruct | MC42867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 5.00 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 49.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1N6JXM7 | 37-105 | QVRFHAAAAANAEDASIWRWFSELLEERRIRWRFQFDRWQVSVDRVSVSEEDTFDLAIRQAKATAEKLG |
| A0A2N9CWG4 | 1-70 | MAAAATANADDASVWRWFAAMLEERRIRWRFMFNAWVVHVDRKEVAIESSFYEAIRSAKCESEQLGLGAL |
| A0A6J5E4Z7 | 3-71 | None |
| A0A495FRQ2 | 5-81 | None |
| A0A3E0C7F6 | 29-96 | None |
| F0G0C5 | 20-83 | None |
| A0A7W8RWF8 | 77-141 | None |
| A0A158CQR6 | 2-68 | None |
| A0A833PNV6 | 34-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.