DPCstruct | MC42861
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 170 ± 30 aa |
| Standard deviation of domain lengths | 29.86 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N1QSU1 | 14-184 | NVASAYDPPSVVHYTIHGTTDRELGSAMRSLGPADPTGRRYPGRADWNVSWTYRWQSQGNRCLLTSPSVQLKGTITLPRWEDRDRAD… |
| A0A2V7RSE7 | 68-221 | PHRGIPWSAARPLSWGDFQGAAPPGGEEAAKTAYGIYYAWKCRGRAFEFQAIAAFHRDDSWVKALVLSDSTESRRVLGHEQTHFDIA… |
| A0A5P3ALX0 | 14-159 | None |
| A0A6I5VPT4 | 4-175 | None |
| A0A7V5YGP0 | 64-235 | None |
| A0A1H7U9R3 | 11-215 | None |
| A0A399SEL9 | 55-214 | None |
| A0A0D3LBH8 | 44-176 | None |
| A0A290S8V3 | 8-132 | None |
| A0A1V5RIR4 | 83-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.