DPCstruct | MC4286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Standard deviation of domain lengths | 10.52 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 36.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0352 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M7NXY8 | 79-173 | AGIESATDALEPAPNGYIDEGFIESEVENGLNQIARISSNLTDETNAIMDQVADIVSLPHLDDSQVQEGVLDARREKNQTVSDLNEF… |
| A0A6L5AXU7 | 2-107 | LEPAGNGFIRQSFLDGEAAQGLVKTESITTSLTEETNTVMQKVSDIVSLPHLRDGEFSAHVRRAELHRRNTVDELITFESQQRQALD… |
| A0A268AG62 | 83-196 | None |
| A0A6I7T8I8 | 2-101 | None |
| A0A6I7SLW8 | 33-139 | None |
| A0A844LPD0 | 67-166 | None |
| A0A7Z2FW01 | 88-195 | None |
| A0A806TTF1 | 79-194 | None |
| A0A7X9MXC5 | 88-196 | None |
| A0A6B3W0J4 | 9-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.