DPCstruct | MC42855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 46 ± 3 aa |
| Standard deviation of domain lengths | 3.24 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 83.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815UC78 | 1-46 | MMTDNNLVRHLDACETMGNASTICSDKTGTLTTNRMTVVQCYFNGK |
| A0A820JBZ1 | 1-53 | KMMTDNNLVRHLDACETMGNASTICSDKTGTLTTNRMTVIQSYITEVIEDNGK |
| A0A822FHR6 | 337-380 | None |
| A0A225VS11 | 162-204 | None |
| A0A183FA83 | 16-60 | None |
| A0A1I7W7W7 | 147-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.