DPCstruct | MC42854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 3.97 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 49.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820H6M9 | 74-156 | RYGSTGPILYIGSLDQAIQDSVCASREERRPLAIYLHNDRSVCANVFCAQVLAGETTIEYLANNYVVWAWDVTSDANRTRYRK |
| A0A2I0TP91 | 89-160 | DCHPVYFIGSLEAAFQEAFYGKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDMTKE |
| A0A817TLZ2 | 25-94 | None |
| A0A820ZW70 | 78-143 | None |
| A0A8B6BIP5 | 199-271 | None |
| A0A1U7TNA5 | 331-400 | None |
| A0A821UTA5 | 52-127 | None |
| A0A819AX67 | 57-128 | None |
| A0A818YE32 | 448-516 | None |
| A0A814EHA2 | 124-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.