DPCstruct | MC42853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 4.62 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 62.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498MPR6 | 369-442 | QVSQYTFAMCSYREKKSEPHELMQLDGYTVDYSDPQPGLQGGRAFFSAVREGDLVVFASNDDQDRALWVQAMYR |
| A0A6P4KYF0 | 144-224 | QVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMFGIDLNGGRFFFNAVREGDSISFACDDENECSLWVMAMYR |
| A0A6I9Q7J2 | 35-108 | None |
| A0A819XNM7 | 4-83 | None |
| A0A816RV47 | 283-356 | None |
| A0A7R9CHH3 | 23-100 | None |
| A0A7J7KTE2 | 629-692 | None |
| A0A663N9W0 | 21-97 | None |
| A0A7R9MRZ1 | 1-66 | None |
| A0A0S7FIK5 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.