DPCstruct | MC42850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 113 ± 8 aa |
| Standard deviation of domain lengths | 7.87 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 53.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820H5R7 | 1-110 | MNIIFNIQKKILSVRGNFNVDELVEEVEKRNRTKLLLPWLETRVHDGSTDPGVHNAVAKIYIDSNSNPEKFLRDNAYYDSRVVGKYC… |
| A0A6V7WV79 | 42-146 | EDTIKQLIQNTRGKFDIDELVDEVEKRNRLKLLSSWLESRVQEGNFDQATHNALAKIYIDSNNNPERYLRENQYYDSKVVGKYCEKR… |
| A0A7J0DFS7 | 190-294 | None |
| A0A819JGR3 | 13-131 | None |
| A0A5E3X500 | 377-481 | None |
| A0A5C2SK02 | 386-498 | None |
| H3CFH3 | 2-130 | None |
| A0A6A4HVL0 | 348-462 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.