DPCstruct | MC4285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 99 ± 6 aa |
| Standard deviation of domain lengths | 5.75 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W9BF34 | 18-117 | TQWPELPATGFIRGRPATVQDAREGSAVFSMNGGGKGPLTSEIPQYAVWTDEHGVKRPAILVQAERAQDGAEMVGLRSLAGSEIVAT… |
| A0A2D7ZLX1 | 12-115 | PEGGGYDTEDWRRLTPFTAAVATLDDVQARRAVFALGDTTDARALEMELPQPVIWWEEDGEQAAVAVQAEVHTNAEGETMEVLGLIL… |
| A0A3B0YDE8 | 34-139 | None |
| R0EGD2 | 3-96 | None |
| A0A3P0XEC7 | 3-98 | None |
| A0A4P5TUA1 | 79-182 | None |
| A0A0J8AHW2 | 6-105 | None |
| A0A2V7W5N4 | 6-94 | None |
| A0A5C1AR58 | 750-836 | None |
| A0A0F2QMZ5 | 10-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.