DPCstruct | MC42848
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 53 ± 1 aa |
| Standard deviation of domain lengths | 1.28 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 94.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 59.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820H5W4 | 1-52 | LKHVETKYLEQYGIKTLDPNHYNYIGDCIHDDDSYDYKRARDFNYHNGPEWL |
| A0A0K0DJW5 | 14-67 | VALDMAKEHLLGPIGIKTLDPSDWAYNGYYNNDDDGCEKKTAKGFNYHQGPEWV |
| A0A812YLP1 | 349-403 | None |
| A0A817IKJ7 | 317-368 | None |
| A0A817LAF4 | 519-568 | None |
| A0A814V5X0 | 876-928 | None |
| A0A448WCG3 | 105-157 | None |
| A0A3P7LH89 | 275-328 | None |
| D6X0Q2 | 15-68 | None |
| A0A0R3WNU8 | 182-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.