DPCstruct | MC42843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 280 ± 28 aa |
| Standard deviation of domain lengths | 27.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 42.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12473 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820EVZ4 | 1-234 | MIDYYAIGYRSCPAAWDPPSTIEIHRPIIFLNLDPIDMNTSNNIAGLQAILNEENKTRMFQLPLIQNASDEIRAVAQWDPTIHESDT… |
| A0A0R3PGF7 | 235-506 | PAPNSDIPGAPCDWQAIFYEVLNSCVINSARLHSRIPPPGVEEHVPVLFLDLNSDDVTGDMTSEEISPKIAGLNSFLPMEQNGGLLV… |
| F1KQE1 | 404-730 | None |
| A0A6H5HKJ0 | 659-952 | None |
| A0A2D4NPL5 | 1-305 | None |
| S4RE50 | 540-798 | None |
| A0A7R9QFC5 | 1-239 | None |
| A0A4W5Q777 | 231-523 | None |
| A0A7R9HY76 | 86-379 | None |
| A0A834PU01 | 826-1107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.