DPCstruct | MC42842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 114 ± 19 aa |
| Standard deviation of domain lengths | 18.69 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.61 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | CL0404- CL0635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820ERS8 | 1-108 | SKKPRARDLGIPFDGVPGKYNAITDVDGIQVGFSTIIEGDSIRTGVTAIFPRRTNSDRSQSPCFANWFSLNGNGEITGIHRLAESGL… |
| R5FRT7 | 100-219 | GDGLTGEKNNICDVEDVKVSHYTLKNDEYNTGLTIISPHSGNIFKEKVIASSYSFNGFGKSIGLVQIEELGTIETNIVFTSTLNVGK… |
| A0A815KGY5 | 1-141 | None |
| A0A2U3E2Y8 | 174-291 | None |
| A0A358SKY2 | 1-76 | None |
| A0A817CIT4 | 161-279 | None |
| A0A8B0KT55 | 1-101 | None |
| A0A0A2WCK5 | 26-138 | None |
| A0A101GAX6 | 85-191 | None |
| A0A4Z1IKK7 | 3-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.