DPCstruct | MC42832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3698 |
|---|---|
| Mean domain length (aa) | 170 ± 36 aa |
| Standard deviation of domain lengths | 35.85 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.24 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 21.22 |
| Pfam Score | 84.21 |
| Assigned Pfam label(s) | CL0213- PF00057- PF06119- CL0489- CL0550 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7FK70 | 20-167 | NCSNVTPNTFLCKCNKDFTGPFCEEPVEHCISQPCLNGGICQNNEHGYVCECLAGYFGHDCEADVNECSSRPCQNGATCIDMSNDVT… |
| A0A8B6GM81 | 75-235 | INECSSSPCHQGTCQDNINGYSCTCNSGYTGSNCELDINECSSSPCHHGTCQDNINGYSCTCSSGYTGSNCELDINECSSSPCHHGT… |
| A0A7M5V309 | 130-346 | None |
| A0A3S1B642 | 385-524 | None |
| A0A3S1B5R8 | 232-410 | None |
| A0A3S1BDH0 | 133-346 | None |
| A0A7M5U9K6 | 344-526 | None |
| A0A7M5UEU2 | 45-242 | None |
| A0A7M5URS7 | 2-162 | None |
| A0A7M5UYL7 | 677-864 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.