DPCstruct | MC42831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 372 ± 63 aa |
| Standard deviation of domain lengths | 62.72 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 24.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14959 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7FHF4 | 7-369 | NLKVFTNKTGSFCLCYSQASNIPKEVTYSVSFLHKGYSKTFTVALQRTDYPQMKEVAFLDLDYYVAVYLPGHFLHLLNIQHPDLMCY… |
| A0A673H8D6 | 96-472 | RLEVFTSQTGTMCVCYSHPVHWHKDATYTIAFVHRGCSKTFTVSLEKGSAPANLPTVHPIFIHLDYYIVVYLADHFLHLINCRQQDL… |
| A0A6I9PMH1 | 277-611 | None |
| A0A5N5TLX5 | 20-430 | None |
| A0A6I9YJT7 | 107-353 | None |
| D3BI04 | 10-426 | None |
| A0A7R9CKX9 | 111-519 | None |
| A0A210PEY3 | 280-760 | None |
| F0ZG18 | 423-870 | None |
| A0A1S3IFV5 | 3-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.