DPCstruct | MC4283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 5.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 95.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 48.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9M7D8 | 131-197 | LNRRRWVRTVDHWPSSRRNYRRMLVNHEVGHRIGHGHRSCPGSGKKAFVMQQQSISLDGCRANWWPR |
| A0A6J4SH59 | 1-69 | MLNVARWLTGADAYPGPLPAYRQYLVNHEVGHLFGRGHESCPGAGQPAPVMMQQTKGLQGCTAVSWPYP |
| A0A1V1W829 | 5-64 | None |
| A0A431IFW5 | 110-180 | None |
| A0A7W7M6E0 | 1174-1242 | None |
| A0A1C4T978 | 1-73 | None |
| A0A839J5W3 | 176-240 | None |
| G8SFR2 | 627-695 | None |
| A0A109S9Y4 | 1-90 | None |
| A0A4D4KEU7 | 766-839 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.