DPCstruct | MC42829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 144 ± 19 aa |
| Standard deviation of domain lengths | 19.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.51 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF17741- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7FG54 | 12-173 | LSSAIQLIQDLMAYEVRPALLKGLVELLKPPGTEAAKGKGKILEELVTHHLAEPLSVHVQQAAAAKTIGILAKDSTKLAEELIQLGA… |
| A0A194AMI0 | 3-150 | YDVSQSILKQLVTKLRPAKEDTIKRPEILEDPEIPKINAPLPVFVQQAAAAKTIGILSRESNEIAEKLIQLRVTHNLLYSMGNMDYA… |
| A0A813U0M6 | 413-577 | None |
| A0A6P7DLD8 | 22-170 | None |
| A0A498NR65 | 155-311 | None |
| A0A7J5ZSQ0 | 471-631 | None |
| A0A819TT03 | 36-195 | None |
| A0A3M6UXE2 | 441-600 | None |
| W5M4L3 | 58-175 | None |
| A0A815CWZ4 | 6-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.