DPCstruct | MC42825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 242 ± 58 aa |
| Standard deviation of domain lengths | 57.55 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 74.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09747 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7F555 | 28-227 | LGCFAHLAARYEVRFYCDEVRRAGRAKAGRTRVRNKRYAALQQLIKGGEYFSDEQMRAREPLLYEQYIGQYLSEEELLALGSQAQAG… |
| A0A0B7AGI0 | 3-183 | EDGLQTLSNRDMENLRNKMINKLIKTDAHFKHQQRGEPDLTEEEKSSIALDILNKSPTLFLERFSTYLSFEDTRYFNDQKGDYLVDF… |
| A0A445DHQ4 | 839-1093 | None |
| A0A2G8LQD5 | 8-232 | None |
| F4PPT5 | 1-334 | None |
| A0A0C2MAF2 | 3-239 | None |
| A0A1S3QUA0 | 1-163 | None |
| A0A834XUD8 | 64-312 | None |
| A0A5J4NLD6 | 264-526 | None |
| A0A5B7EYA1 | 56-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.