DPCstruct | MC42824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 144 ± 20 aa |
| Standard deviation of domain lengths | 19.97 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2FXJ9 | 20-172 | LCPQLVPKPLWGVSLAKLVRMRTSELIRLGLEPGVVGELKSFWLALPRDKCVVCGSKASDIDEFWSYHVDDGRGLARIVSLRSLCGS… |
| A0A2P6U325 | 229-377 | EVHAWPAALRPHLNLASQLARDEAWQRLQQDAFARAQGRCEVTSAFLESPAAAVAPRWQCDEPARVLRLVGLRAEAPEVQQVGALLE… |
| A0A1P8UBF6 | 2-93 | None |
| A0A2K3J5G9 | 10-170 | None |
| A0A3C1DPT0 | 4-149 | None |
| Q97XL4 | 28-211 | None |
| A0A7S3LNI9 | 219-357 | None |
| A0A5P9C0U1 | 149-290 | None |
| A0A842RQE0 | 17-143 | None |
| A0A0F9N373 | 13-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.