DPCstruct | MC4282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 155 ± 18 aa |
| Standard deviation of domain lengths | 17.98 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K9P7R2 | 304-463 | AGLEVIEGIASIALLPSGSISGHFVSVPNSVCYGLQGTELPCERECSRGEDFRLIKLSVIDYYRKKDSVTVIECRGHDAARFHTVEH… |
| A0A3R7PBG9 | 128-268 | NMNGPHVEISGVATLCFDEEGTWFQGSITAEDDAQYAIYGTKSLRKRSGTDACACPGLDAGPGVPVTFDIRVVDCEVGEEYSLKRVH… |
| A0A6P8IH32 | 2-138 | None |
| A0A1Y1XUW0 | 1-173 | None |
| A0A0B2V0K2 | 50-224 | None |
| A0A7S0L7S1 | 113-269 | None |
| A0A507FA15 | 1-174 | None |
| A0A0N4VGM7 | 51-194 | None |
| A9SJJ3 | 5-153 | None |
| A0A4Y7JK66 | 1-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.