DPCstruct | MC42814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 98 ± 14 aa |
| Standard deviation of domain lengths | 14.14 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378AN41 | 14-101 | NQEIRGLVEQTNSALLNENANKDSKVIPTQRDLLAGIVAKHYARQHLLPHDVVMAHERGMIHYHDLDYSPFFPMFNCMLIDLKGMLTQ |
| A0A495P2K3 | 23-100 | SVNEYLDRADWRVNANANQDYSLGGLILNVSGKVVANYWLSHVYPPAVGEAHRRGDLHIHDLDMLAGYCAGWSLRTLL |
| W4TTV9 | 111-221 | None |
| A0A2X1PL82 | 55-144 | None |
| E7GEL9 | 127-240 | None |
| A0A377E4P8 | 60-178 | None |
| T0EEP7 | 1-99 | None |
| A0A7X9I4K8 | 3-94 | None |
| A0A837DW88 | 104-183 | None |
| C2WAD7 | 12-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.