DPCstruct | MC42813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 204 ± 28 aa |
| Standard deviation of domain lengths | 27.57 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 25.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11843 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A329P2W9 | 137-349 | GLAEELRPGGWRLEEGLEDTLRRMGERGDIIKTLHREMGDRDIARSPADYAIHDPTDPHTKPVTGRVVARGLSDEINDRHYLIVDAT… |
| A0A1K2FAF1 | 1-200 | MGLATEHAPGIWELSERLGPALRELGERGDIIRTMQKALGPQGGERDPMSFQIHDGAPETPIVGRVVDKHLTDELGENLTIVVDGID… |
| A0A4Q4XFD0 | 946-1245 | None |
| A0A522SRB3 | 69-255 | None |
| A0A2W1K857 | 223-431 | None |
| A0A0L1KDX6 | 210-400 | None |
| W5Y734 | 1-211 | None |
| A0A2V9ACH0 | 145-329 | None |
| F3S285 | 209-397 | None |
| A0A0C1MT31 | 304-533 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.