DPCstruct | MC42809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 99 ± 11 aa |
| Standard deviation of domain lengths | 11.44 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 93.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A086L221 | 295-393 | IDQLFVRFGVEILKIVPGVVSTEVSAALSFDVQASVEKARKLIRMYKEHGIEKDRVLIKLATTWEGCEAAKILEKEGIHCNMTLLFS… |
| A0A1L9TGM8 | 2-97 | CKANIGNIKGRELLQTLPSYAYNTEKTVEHGPCCIKIPATGAGLSAWQTLLRDGIRTLGTAVFSVHEGIAASQAGCLYISDYYNGAP… |
| A0A2T7D3L7 | 153-262 | None |
| A0A1Q9CZ61 | 125-224 | None |
| A0A7S1ZTE3 | 172-265 | None |
| F8PS80 | 5-103 | None |
| A0A168KK19 | 2-98 | None |
| A0A066WYD3 | 89-191 | None |
| A0A7V1D6Q2 | 105-189 | None |
| A0A6B9Z5A3 | 2-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.