DPCstruct | MC42804
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 68 ± 0 aa |
| Standard deviation of domain lengths | 0.42 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 92.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 46.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4W4B8 | 56-123 | VWLDPQRTSPFDLYQYFVRRPDGEAERLLLLFTFYPPAQVAAIMEKHHEKPESRHAQKKLAESVTTLV |
| A0A3S9W8U9 | 122-188 | WLDAAMCSPYRMYQFWLNTDDADVISRLKVFTFLPKAEIEELGQLVAAEPFRREAQKRLAREVTAFV |
| A0A7J7A3U1 | 850-916 | None |
| A0A2P2I3C0 | 374-441 | None |
| A0A7R9AJ16 | 79-146 | None |
| T5A9A9 | 281-348 | None |
| K2RFQ6 | 28-95 | None |
| A0A1V9Z361 | 434-501 | None |
| A0A1W4WGS7 | 60-127 | None |
| A0A1W4W5B1 | 13-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.