DPCstruct | MC428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 107 ± 13 aa |
| Standard deviation of domain lengths | 12.83 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0KM65 | 24-123 | VGIVINICYGGFGISEWARQQFKERARADGYIPQPERTDEKLIDLIEAHGSRVNGLCSSLIIEYIPNDYYINKCYRIDEYDGSETLV… |
| A0A2V8RUP1 | 27-147 | NQTTGRRLIMKLVLNKTYGAFHLSDTALCRIAHLKGKNIYPQEVEGYTCYYEDPDFNESTYWDPYTWDRTDPDLVRAVEELGQLAGE… |
| A0A2D6WZ90 | 15-121 | None |
| A0A843HJP2 | 2-117 | None |
| A0A1X1Q408 | 1-101 | None |
| A0A3A5H9J3 | 1-100 | None |
| A0A6C0IEK8 | 4-101 | None |
| A0A7T9DZ41 | 1-124 | None |
| A0A6C0EA76 | 2-116 | None |
| A0A383E0T7 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.