DPCstruct | MC4279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 151 ± 10 aa |
| Standard deviation of domain lengths | 10.49 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 48.04 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | CL0023- PF06777 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F8PDX0 | 3-148 | FVDVVIYSFHYLLDPKVAEQVSKELSKDAIVVFDEAHNIDNVCIESLSIDLTRPMLDSAARSVTKLGEKIEEIKTTDAAKLQDEYAK… |
| A0A0K9P269 | 3-170 | RMMIKYANVVIYSYQYLLDPKVSGIISKEMQKECVVVFDEAHNIDNVCIEALSVNVRKQTLEGAGRNIGKMTEVINRFTATDAGRLR… |
| A0A452XYK2 | 75-221 | None |
| X6MSX8 | 1-155 | None |
| T1GBR3 | 108-247 | None |
| A0A2K3JKU6 | 2-169 | None |
| A0A1I7XS21 | 16-153 | None |
| A0A0L0SYX0 | 1-165 | None |
| A0A0K9P1E9 | 2-147 | None |
| A0A251V3S2 | 124-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.