DPCstruct | MC42786
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 81 ± 11 aa |
| Standard deviation of domain lengths | 11.34 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20069 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5VQD9 | 3-86 | KQTTTEKAAATPAKKTASRKKVVFTLQFAGKELTVAEMEALAVAAWMEQTGGLKKDAKDIQLYAKPEDSMLYYVINGESGSVAL |
| A0A3A8ZHD2 | 3-73 | KERNEVVPEVVLQYREYEVNMDDVVARVKAHYVAKGHKEASIEDIQVYVKPEDFTAYYVINDGVVGKVNLF |
| A0A395Y7Y1 | 94-182 | None |
| A0A859DM12 | 64-142 | None |
| A0A1H9A3I8 | 139-229 | None |
| D4LE41 | 35-114 | None |
| A0A351UUN3 | 55-122 | None |
| A0A1V5GJN8 | 263-327 | None |
| R6JZ34 | 135-217 | None |
| A0A373LVA0 | 6-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.