DPCstruct | MC42784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 57 ± 5 aa |
| Standard deviation of domain lengths | 4.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 67.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00346 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2B4S4S7 | 378-429 | MEALIHHFKLYTEGYQVPPGTTYTAIEAPKGEFGVYLVSDGTSRPYRCKIKA |
| A0A0P1BSF4 | 1-59 | MESLIHHFKYYSENISVNSGETYTVIEAPKGEYGVYLISNGTNKPYRCTLDVVFGEIDR |
| A0A0G4MT84 | 209-272 | None |
| A0A385G282 | 2-60 | None |
| A0A1I7VR18 | 388-440 | None |
| A0A674HEU8 | 527-578 | None |
| A0A383W916 | 388-439 | None |
| A0A6A5KV31 | 397-460 | None |
| A0A0G2H8I6 | 379-440 | None |
| A0A287TZQ4 | 30-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.