DPCstruct | MC42783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 159 ± 21 aa |
| Standard deviation of domain lengths | 20.77 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6RU22 | 366-510 | GTTDVVIVDRLSIQSLLPETSVRIVMELKKSVQEKDVLQAMIELITADLKSNYTVLTVLTDLNDSWHFFWIADKKVKTCVLNRNEAV… |
| A0A0P1AX68 | 2-156 | LIEVKKVVKAGSGFQALSELIALDFLVDDPVMALLTNLTDHWQFFWVSEKNNSYVIIQTTTVTEPGAAFAVIRTLLAQSPIGDADIT… |
| A0A833WMU0 | 1-117 | None |
| U9SKI1 | 207-395 | None |
| A0A421G056 | 127-289 | None |
| A0A3F2RJR8 | 522-686 | None |
| A0A2H5SUN4 | 48-180 | None |
| A0A6G0RTJ9 | 270-428 | None |
| A0A2K1IWP6 | 225-406 | None |
| K3X578 | 21-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.