DPCstruct | MC4278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 773 ± 118 aa |
| Standard deviation of domain lengths | 118.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 45.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01937- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K9P1G7 | 1-901 | MGENPTKGQHTEAFNNKKDTRNMEGEEKEERGERETSPTDMMHRSNSRPLLDVSRAAIQANSEDRNPTILLPNQSDDICHLALDIGG… |
| A0A2D4HK57 | 1-626 | MTCLIKGCNFVLKNIPHEAFVYLKDADPEFRFQMNHPHIFPYLLVNIGSGVSIVKVETEDKFEWIGGSSIGGGTFWGLGALLTKTKK… |
| A0A835JCY6 | 38-1020 | None |
| A0A4U6W9G9 | 1-782 | None |
| A0A7I8VBT9 | 165-945 | None |
| A0A3Q2ICT0 | 185-998 | None |
| A0A804QE55 | 1-638 | None |
| A0A4P9YPI5 | 6-628 | None |
| A0A0D2WRM2 | 1-806 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.