DPCstruct | MC42779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 92 ± 13 aa |
| Standard deviation of domain lengths | 12.61 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0MXM9 | 20-99 | LPPRRVTPPNKDRHRIARIDQRTRARATTSVVESWVDLAGDVAAINRGEAIRQGETYYINGRTHRVKANGAAFPVSGDGV |
| A0A7X6W2G8 | 37-116 | NKPKTPLRMSAERHYITKVRANSIVKKINSVVEPWVDVKADVEAINVGKARRDGEFYHINGRIYTVHNGRAVPVSGDGVH |
| A0A7W0KF64 | 19-99 | None |
| A0A640VSW4 | 371-463 | None |
| A0A066Z295 | 73-183 | None |
| A0A1W1XUI4 | 234-326 | None |
| A0A1S7NHX5 | 81-156 | None |
| A0A661CTC2 | 108-182 | None |
| A0A345HTJ9 | 279-391 | None |
| A0A4R7PP63 | 103-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.