DPCstruct | MC42777
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2800 |
|---|---|
| Mean domain length (aa) | 233 ± 61 aa |
| Standard deviation of domain lengths | 61.08 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 86.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 11.75 |
| Pfam Score | 95.03 |
| Assigned Pfam label(s) | PF01594- CL0015- CL0177- PF10565- PF03900 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0L3C4 | 16-234 | LGDITVFAAASLTEAFTELGELMEDEQPGTEITFNFASSSDLALQIGEGAPADVFASANPVQMEVVEDEDLAEEPVVFVTNKLVILI… |
| A0A381GXC7 | 14-171 | GDKLTNNPKSRLVFLGWMDSGTRNLITKNPVEKPEDLHGMKIRVQGSPVALDTLKDMGANSVAMGVSEVFSGMQTGVIDGAENNPPT… |
| A0A5C1DKH3 | 3-127 | None |
| I7JFC9 | 20-163 | None |
| A0A1B0C6Y1 | 200-374 | None |
| A0A7L5Y1P0 | 90-302 | None |
| A0A7S2U9M2 | 1-288 | None |
| A0A0E0GFS3 | 553-718 | None |
| A0A7Y3J0K2 | 190-388 | None |
| A0A2G8LE34 | 79-478 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.