DPCstruct | MC42770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 142 ± 15 aa |
| Standard deviation of domain lengths | 15.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A655S715 | 1-121 | MDPDKKLKEALNLKDALVFECTDMSLKVHKDAKGKSQLQVTYHGQDAVQVHQFWPLNTPRQKQQFHDQFVRPHLADKHRPFEAATPA… |
| A0A376ZHU0 | 201-318 | VDPDDMLKAALRLKDALVLRCSGMSLQHGHDEKGEWLKITYYDEDGADVSERFRLQTPAQRTAFEQLFIRPHTRTPGIPLRWITAAD… |
| A0A090S2G0 | 30-173 | None |
| A0A376ZKI1 | 7-149 | None |
| A0A3S4H3G6 | 1-125 | None |
| A0A655VW74 | 1-125 | None |
| A0A4P0YB47 | 211-360 | None |
| A0A0A2W5F4 | 175-326 | None |
| A0A485C186 | 150-283 | None |
| A0A5M6D8I6 | 725-894 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.