DPCstruct | MC42768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 148 ± 23 aa |
| Standard deviation of domain lengths | 23.42 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X4ZZN4 | 122-275 | TQMHYARKGIITPEMEFIAIRENVDPEFVRSEVASGRAIIPSNINHPESEPMIIGRNFLVKINANIGNSAVSSSIDEEVEKMRWATH… |
| A0A843EHY8 | 6-120 | EEARRGITPLVKRIAEKERMSEEFVRNGIASGRIVVPCNPIHNPEPGAVGEGMSIKVNVNLGTSRDMPDLDPDLRKLDGALTSGADA… |
| A0A0J1FFD3 | 10-138 | None |
| M6RKJ2 | 84-217 | None |
| F0NNI8 | 3-159 | None |
| A0A7C3XTM9 | 97-251 | None |
| A0A495AAS8 | 95-257 | None |
| W0IQ09 | 126-304 | None |
| A0A1B0C474 | 154-313 | None |
| A0A2I0D266 | 24-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.