DPCstruct | MC4276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 53 ± 2 aa |
| Standard deviation of domain lengths | 2.12 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K9NS20 | 1-53 | MQPGYERLCCLRCIQPRDHNFQTTCVCRVPKHLREEKAIECVHCGCRGCASGD |
| A0A0R3W2Q3 | 77-128 | KKQGYENLCCLRCIQPRDTNFGTNCVCRVPKSKLEEGKVVECQNCGCRGCSG |
| A0A812TQ36 | 146-197 | None |
| A0A7S1X046 | 58-112 | None |
| A0A4S9U0I9 | 186-239 | None |
| A0A6U4NMS9 | 95-146 | None |
| A0A368G3A8 | 223-274 | None |
| A0A5N5I7N4 | 509-558 | None |
| A0A6H5LKG7 | 19-70 | None |
| A0A0E9NL32 | 149-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.