DPCstruct | MC42754
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 180 ± 9 aa |
| Standard deviation of domain lengths | 8.94 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 30.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08352 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534LNU1 | 1-172 | MYLGKIVEEGPTRELIKNPRHPYTKALVSVVPVPDPDRRRQRIILKGERPDPSDIPPGCRFHPRCPVAFERCGWIAEEVVTELKDLS… |
| U1R0J9 | 1-188 | MYLGRVVEVAETETLFDEPRHPYTQSLLSAIPVPDPTAETDDRVILEGDVPSPVDPPSGCHFRTRCPQVIPPEGMGIDQATFRAVTN… |
| A0A2R6CR52 | 254-442 | None |
| M0JBR4 | 654-826 | None |
| A0A1H2QLZ7 | 1-188 | None |
| A0A0P7GCC7 | 58-244 | None |
| A0A0P7H6V3 | 425-609 | None |
| L0ICW9 | 493-680 | None |
| A0A534JKA7 | 221-398 | None |
| A0A534M2A2 | 31-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.