DPCstruct | MC42751
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 137 ± 20 aa |
| Standard deviation of domain lengths | 20.44 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 33.70 |
| Pfam Score | 98.84 |
| Assigned Pfam label(s) | PF05154- PF10708 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7GS27 | 6-129 | CRYCYQTETTEHECNIRKDCKALEIPSKRRYNTTCTVKETTLCLGNRTFGKILICNWTSGYRWSTAALLSLTLGGFGVDRFYLGYWK… |
| A0A6H5ICJ5 | 203-330 | KTYICRYCYQTEPSEHRCLKKNACNSVASPKQYYRSNCTVYGNILCLGNRIFNKNLPCNWTSGYKWSTALILSITLGGFGADRFYLG… |
| A0A813U7K2 | 213-347 | None |
| G4LZX5 | 134-275 | None |
| A0A4W2GHW7 | 39-172 | None |
| A0A354SBF7 | 175-308 | None |
| A0A819NMF2 | 184-344 | None |
| A0A287D890 | 7-118 | None |
| A0A7E4VYW8 | 15-159 | None |
| A0A6A5D310 | 55-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.