DPCstruct | MC4275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 166 ± 23 aa |
| Standard deviation of domain lengths | 23.22 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14968 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q08CH9 | 1-150 | MGPFYCSICGKTDFSGKGHIYGKSHQSKLKIILVKFTEKVKEARRTIKSPQVEKYGPHHDVKFWCYCCTLEVQKHVTDSNITVLYGG… |
| A0A0K9NQB6 | 22-208 | ATFEFCKVCKLNNNQGRKHKYFPTHAKKVASLLSRFLQKLSDVKFFLTNPSFLLPNLAERGRLWCVFCELDLSDVGSTFVCGNVIYH… |
| A0A4W3HRL6 | 62-249 | None |
| A0A1S8W983 | 60-280 | None |
| W1NJ27 | 7-140 | None |
| A0A6A4Q3P5 | 3-140 | None |
| A0A0L9UU66 | 1-129 | None |
| A0A2U1QJX5 | 4-174 | None |
| F4PA64 | 18-213 | None |
| A0A2G5E5T3 | 16-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.