DPCstruct | MC42747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 162 ± 17 aa |
| Standard deviation of domain lengths | 17.02 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7STA3 | 30-205 | STSRHNHRAERIWPEVNSRINYPIKRILIQLENDNRINMSDEVHKFCVSWVTLKVIAMPVQRFVNSWNDHTIPGNRGGIPNNLAASF… |
| A0A6S7G6I5 | 1-146 | MANDELINMDDDITKFCVSWFVSRVADTGIKQVIDGWNNHPIPGKGIPNERMQANNKACLLPTQDLLPSKEQAVALYESEGGNITLP… |
| A0A6A5FG91 | 1-132 | None |
| A0A1Y2H9K5 | 196-373 | None |
| A0A7J6DFQ9 | 381-553 | None |
| A0A6A4T2A2 | 116-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.