DPCstruct | MC42731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 153 ± 32 aa |
| Standard deviation of domain lengths | 31.93 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.11 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | PF08969- CL0366 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822DVE2 | 15-153 | IQWLLENQCRIPVRSTTPIHYYYKTSDTLIDQADYYYQTNQFEQSFILYSRYITLFVEELKKYHRDFPNVSINDRERVKDIIRTKAF… |
| A0A183PVM0 | 5-112 | PQERLDALLKSAEDFAIIQNIDISHYARFIRSMFRLSVQFSEAGQKERAYILSIRAVLCIRELPNHNGYQRLDPRVQSELKSLGKLL… |
| A0A4Q2D1Y6 | 2-151 | None |
| A0A0R3QBS3 | 10-163 | None |
| A0A1Y1W5J9 | 19-145 | None |
| A0A446NEF9 | 1-153 | None |
| A0A835GU32 | 1-161 | None |
| A0A6A4Q781 | 5-124 | None |
| A0A5D2TLA3 | 8-128 | None |
| A0A6V7PGL9 | 9-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.