DPCstruct | MC42729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 59 ± 4 aa |
| Standard deviation of domain lengths | 3.94 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 49.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822DEG2 | 3-52 | IPSNAIVIELAPHCLLLAILKRSLSTDCVHLNLMKRGTHDHIAYFYSNLG |
| A0A7R9F494 | 69-129 | SPVLFKEALAHVPENAVVIELAPHCLLQAILKRSLGPTCTNVGLVKRLHPNNLEFLFSALG |
| A0A7R9DAT3 | 110-169 | None |
| A0A2C9JTZ0 | 124-184 | None |
| A0A7R9CSR7 | 532-593 | None |
| A0A7R8VW23 | 44-105 | None |
| E2ABR5 | 173-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.