DPCstruct | MC42727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 169 ± 13 aa |
| Standard deviation of domain lengths | 13.39 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7KMT8 | 231-427 | QKLHDLLRVGSKLAVRDGKMSVEDQKKYFWSVTEEEVYKGVLSQQNPNDHTLCFVREIYDIDYSHSKVERFVELEDGTKKVNEETTQ… |
| A0A822D140 | 11-182 | LCFLREIENIHEHLFDSKISKYIDMCHSKTGELIIDSEAENLLQNLKKSRIPSKLQSSNIFSYQVHWTSNGINRHDHATYIAQFNND… |
| A0A315W8C2 | 225-411 | None |
| A0A151P9W7 | 254-429 | None |
| A0A815WZB2 | 118-267 | None |
| A0A815NPM6 | 34-220 | None |
| A0A818NA15 | 19-161 | None |
| A0A821L3W6 | 90-250 | None |
| G3NZY7 | 151-326 | None |
| A0A816QJE4 | 227-382 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.