DPCstruct | MC42724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 139 ± 12 aa |
| Standard deviation of domain lengths | 12.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822CX46 | 3-149 | NNRIEKCFQYVFKRFLHIWSQENFIRFSSNNQHLYICQCISICLSFNQQIQLNNDKDTIIMCVLNGIRLHLESTFDYIRRRGQLIGE… |
| A0A6P7WUN7 | 323-439 | DSSRRPLLMQVLKELLETWGSSSAVKHSPIEQQLYISKAILICLCHLKEEELESHKQELLSYLMAGVQCHLDSNLLQVRRLGMIVAE… |
| A0A7E4RCX4 | 696-834 | None |
| A0A814M947 | 50-212 | None |
| A0A817MLP4 | 94-231 | None |
| A0A183RNX1 | 195-336 | None |
| A0A4P9YWV4 | 15-151 | None |
| A0A2A3EH18 | 364-497 | None |
| A0A819EHW9 | 675-823 | None |
| A0A287U7R3 | 133-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.