DPCstruct | MC42720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 144 ± 11 aa |
| Standard deviation of domain lengths | 10.73 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19274 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R8PWA3 | 1-138 | MREMAGSWQMTVELKMGLFSETESEADPLAASEESQPFPRPPNVTPHSHWIEFLIQRFEIAKYSSADQVEIFTGLLQRALSLSVGGR… |
| A0A822BCC5 | 375-511 | EEIYKVWEKIISDRHGLYSIDKLEPSPLAPSEKEELKPKPPSVKPHRIFLRFIEERVFLCMHKADIEMEMLVDLLHKSLSLILENSK… |
| A0A670ZGM5 | 1-146 | None |
| A0A7E4RGV4 | 166-302 | None |
| A0A3P7EVW6 | 1135-1301 | None |
| A0A6A4V1X6 | 548-684 | None |
| A0A1I8FKE5 | 237-377 | None |
| A0A820BUY9 | 240-376 | None |
| A0A7R9HL73 | 234-370 | None |
| A0A2I4ALK9 | 1-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.