DPCstruct | MC4272
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 96 ± 9 aa |
| Standard deviation of domain lengths | 9.10 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 33.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7G5M0 | 1-94 | MTDLNTVRKGLVALSVEQTLLEIGGGKLLNEVLTILFEKYHSYLPNCYENPEYLIGACKELGEGLSKEIRRSLRKRLEEFSYQGQIE… |
| A0A2H1EGY7 | 43-128 | DLVHKALVGLTIEQVLLKIGKPIYDKAASVLNEKYQCYIFDCYDNPQYLSTVLEELFGDAHHVVVKEIKKELMIFSHKYRISQFVE |
| A0A2A3TDI7 | 8-99 | None |
| A0A7J4RSP1 | 38-143 | None |
| A0A1Q7P1K8 | 1-116 | None |
| A0A522XP00 | 70-161 | None |
| A0A533VKE3 | 79-184 | None |
| S2EW55 | 11-103 | None |
| A0A0D5C216 | 2-91 | None |
| A0A128A4H4 | 16-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.