DPCstruct | MC42715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 118 ± 14 aa |
| Standard deviation of domain lengths | 14.48 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 45.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A024YT49 | 4-125 | HLRLRAFASTIKDVGTDEVTARSQALRPDIGAAGLPFLHRFVELALAFHHAVRGEDQDRAAAIGRLRALTANGDFAYFTDIAHLMAG… |
| L8F1F3 | 110-239 | QLLDQLDQRATVLYARVAALVRDAGTDRDVTHRATVLRTEATTAGLPWILPLLETALAFHHAVRGAHDDLTATLGRLREATANGDFA… |
| A0A1H6EDG5 | 3-112 | None |
| A0A6N7KXH8 | 154-286 | None |
| A0A2V2AQJ5 | 2-91 | None |
| A0A6G2XKW2 | 10-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.