DPCstruct | MC42714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 107 ± 13 aa |
| Standard deviation of domain lengths | 13.09 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1K2BQP7 | 1-98 | MTSVDNVLRRPCAGPAVWKGPDLANSTEWVLRLSPAQTGELDAALRSVRERGLPLLKVTADDFPLPTLAGELARLTDVLENGRGFVR… |
| A0A1Q3E5I0 | 211-310 | SQLPSGFPSRVEGPIVWEGKDWISEDQWVFHLSPAHLQEIDDALAHFKALNRAMGYISNDTFPLPTLSKILVSLANELYSGRGFFVL… |
| A0A7X1TYI3 | 16-139 | None |
| A0A2P5VKL7 | 2-88 | None |
| M1W1Y7 | 103-191 | None |
| A0A6G1MEP2 | 2-106 | None |
| A0A2V6RQ61 | 41-142 | None |
| A0A1Q5QB87 | 309-438 | None |
| A0A7J7Q9H9 | 16-116 | None |
| A0A162LNE1 | 21-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.