DPCstruct | MC42713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 246 ± 34 aa |
| Standard deviation of domain lengths | 33.59 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 18.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9DP50 | 153-417 | SPDYPLDNPGEDDGRLGHYNDDSVTFKVTCEKPKNDITSVNVRTWADYDDVSFTDRLTLIELAADAAYKAADHFRCTPEQRLPGTFA… |
| A0A1K1X5Z6 | 29-259 | ADMALLGDGLPGLASSSRAWLALPQSCTGRDEFTGPTVVDIAMGPTGLDLGSDYEREDRAALTRALVEVTNGVIRDFGCSGTYRTPR… |
| A0A7Y6E2Z6 | 36-304 | None |
| A0A6C1C3I0 | 13-262 | None |
| A0A1H9VCM8 | 165-465 | None |
| A0A1W7CWN3 | 63-317 | None |
| A0A2S3Y5G9 | 5-274 | None |
| A0A3N4TSR0 | 17-265 | None |
| A0A7K3HF59 | 2-222 | None |
| A0A1Y2P295 | 14-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.