DPCstruct | MC42712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 104 ± 6 aa |
| Standard deviation of domain lengths | 5.90 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0EZN7 | 1-101 | MAQTQYPEFLYHVKRTVTDFHEDKSGATRTTDILATFTDLPAAKKAAYGALESEGYLRDDFESYESKAETEQWSHGDGVLVFAKAPA… |
| A0A370U038 | 114-207 | LYYVLQTTINYDADRSGAAQTTEIEGIFADRHAAEKVAKHTLLAPGDDIKRKSYAEYDDKAAFKGEWPYGDDCFVHAVSNTGQNFIV… |
| A0A1L9RM00 | 1-108 | None |
| A0A177AI66 | 1-114 | None |
| A0A5M3YSQ2 | 412-517 | None |
| A0A2T5M7G1 | 126-229 | None |
| A0A179GWJ2 | 147-258 | None |
| F9GCX4 | 1-102 | None |
| A0A447CB26 | 31-138 | None |
| A0A4E9EPP4 | 199-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.