DPCstruct | MC42711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 341 ± 37 aa |
| Standard deviation of domain lengths | 37.31 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0EWI7 | 25-346 | MNLSTHDEKLLGSHLGLTKETCDTMKSQTKIEHAFEMWEWLLEYAQSFESRHLFYEVSVPTYECNDPIETVYSDDFERDKIKNKWLE… |
| A0A5N6K3S3 | 4-333 | ILSLEILIIPRGVEQNWGSDENYGDESQLAITLYPLERLRNIPRFKIRPAEFHEIPKFAFSSGESLAVEFTPILPDPVDEVRLVTLI… |
| A0A5N6KCZ1 | 96-467 | None |
| A0A4Z1FVK9 | 196-509 | None |
| A0A132BC79 | 160-500 | None |
| A0A2V1BJK9 | 1-274 | None |
| A0A4Y8D8X3 | 13-378 | None |
| A0A0C3H9Y8 | 157-425 | None |
| A0A5N6K2X7 | 385-770 | None |
| A0A2J6T6Q9 | 209-614 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.