DPCstruct | MC4271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 62 ± 8 aa |
| Standard deviation of domain lengths | 7.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F3KKN1 | 199-252 | MLSPLKQMANGISPGDVQCKEGFGVYKRTFDDSAVCLHPSSGEKLILRGVVVHF |
| A0A1Q7G274 | 58-125 | GVNETVDVTKNNIVIAPPLKQLKNGVSINDIKCIDGMQLILKKEDGSPACVKPEDATTLTERGWAQAP |
| A0A7D5M5J5 | 175-235 | None |
| F3KIY3 | 203-256 | None |
| A0A2H9MV30 | 34-91 | None |
| A0A1Q7CV19 | 348-399 | None |
| I3D4K0 | 2-52 | None |
| I3D0Z0 | 4-64 | None |
| K0B7V4 | 116-176 | None |
| K0BC55 | 379-441 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.