DPCstruct | MC42700
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 185 ± 16 aa |
| Standard deviation of domain lengths | 15.58 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.90 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | CL0221- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0EIE1 | 6-199 | TPPQNVEATSTEVALTGGEVAPPAERKMKKIIRKKKRPARPQIDPSMMKSEPPPQTGTIFNIWYNKWSGGDREDKYLSKTAAAGRCN… |
| A0A7S2H0G1 | 125-328 | KEILKRPSRKQAEQIASKNSVLEGAYEYNIWYGKFMGDHWDSKKGKDPAESRCKLLEYAGYTKADKHMNNAKFFCLFFARGCCAYGK… |
| G0R3J4 | 42-200 | None |
| A0A7S0DTI7 | 8-178 | None |
| A0A0D2N5H5 | 13-178 | None |
| R1ESA2 | 1-178 | None |
| A0A146I293 | 7-192 | None |
| A0A1Y1YJY9 | 9-190 | None |
| A0A812JG73 | 40-244 | None |
| A0A2R5GTT4 | 115-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.